PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010109894.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family G2-like
Protein Properties Length: 411aa    MW: 45505.1 Da    PI: 6.7567
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010109894.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like104.27.6e-33265320156
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                     k+r++W+peLH+rFv+a++qLGGs+ AtPk+i+elm+v+gLt+++vkSHLQkYRl+
  XP_010109894.1 265 KQRRCWSPELHRRFVDALQQLGGSQAATPKQIRELMQVEGLTNDEVKSHLQKYRLH 320
                     79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.564262322IPR017930Myb domain
SuperFamilySSF466893.48E-18263323IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.9E-30264323IPR009057Homeodomain-like
TIGRFAMsTIGR015578.3E-27265320IPR006447Myb domain, plants
PfamPF002495.2E-8267318IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 411 aa     Download sequence    Send to blast
MELSLVFVPK TISDIISEVS AIGDCSQKLS KLEDYVKRLE EERTKIDAFK RELPLSVLLV  60
NDAIGRLREE EKAIKSEETR GIVELMPLKG NSEIGGVKSE SDFSDKRNWM SSAQLWMSSN  120
VDSDPDKQTT PMSDLKTRSE EEERSQVSTG VCNYRSRGAF VPFKVGASSQ SQVPSLSLMP  180
PMPELGDSKK NDNNPTSKTS HGSTSITCRG VSGSNFLTDQ VKLATKSQTQ QQQQQQTNNH  240
HHHQQQQQQQ TNNNHHHQQQ QPFRKQRRCW SPELHRRFVD ALQQLGGSQA ATPKQIRELM  300
QVEGLTNDEV KSHLQKYRLH VRKLPNSSGA QGGSGLWMAQ DHSGDNSKAN NTNMSQSSSP  360
QGPLGASGSN KALSNTGDDS MEAEEDEKSD GHSWRGGGGS GDNHKAVEED V
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00629PBMTransfer from PK14402.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010109894.10.0Two-component response regulator
TrEMBLW9S3N80.0W9S3N8_9R
STRINGVIT_07s0197g00060.t011e-107(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF120834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G49560.13e-37G2-like family protein